Advanced Search



Anti-CD247 antibody produced in rabbit

SIGMA/SAB1411621 - purified immunoglobulin, buffered aqueous solution

Synonym: CD3-ZETA; CD3H; CD3Q; CD3Z; T3Z; TCRZ

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1411621-100UG 100 µg
$580.00
1/EA
Add To Favorites
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between CD247 and CD3E. HeLa cells were stained with anti-CD247 rabbit purified polyclonal 1:1200 and anti-CD3E mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting CD247 rabbit polyclonal antibody. Western Blot analysis of CD247 expression in Raw 264.7.
Western Blotting CD247 rabbit polyclonal antibody. Western Blot analysis of CD247 expression in IMR-32.
Western Blotting CD247 rabbit polyclonal antibody. Western Blot analysis of CD247 expression in rat brain.
Western Blotting CD247 rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse kidney.
Western Blotting Western Blot analysis of CD247 expression in transfected 293T cell line by CD247 polyclonal antibody. Lanes Lane 1: CD247 transfected lysate (18.70 kDa). Lane 2: Non-transfected lysate.
Western Blotting CD247 rabbit polyclonal antibody. Western Blot analysis of CD247 expression in mouse brain.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous solution
mol wt antigen 18.7 kDa
NCBI accession no. NM_198053 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) proximity ligation assay: suitable
  western blot: 1 μg/mL
UniProt accession no. P20963 
Biochem/physiol Actions: T cell antigen receptor ζ chain (CD3 ζ)/cluster of differentiation 247 (CD247) functions as a key signal transduction component of the T cell antigen receptor (TCR) complex. The encoded protein facilitates optimal effector T-cell function by enhancing receptor expression and signaling. Mutation in the gene increases the risk of susceptibility to systemic lupus erythematosus (SLE). Reduced expression of the gene has been observed in T-cells of cancer, lupus and chronic infectious diseases such as leprosy and tuberculosis patients. CD247 serves as a potent biomarker for determining progression and severity in patients with type 2 diabetes.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: T cell antigen receptor ζ chain (CD3 ζ), also known as cluster of differentiation 247 (CD247) gene, spanning 88 kb of genomic DNA, is mapped to human chromosome 1q24.2.
General description: The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)
Immunogen: CD247 (NP_932170.1, 1 a.a. ~ 164 a.a) full-length human protein.

Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top