Advanced Search



ANTI-CDK8 antibody produced in mouse

SIGMA/SAB1411939 - clone 5H4, purified immunoglobulin, buffered aqueous solution

Synonym: CDK8; K35; MGC126074; MGC126075

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1411939-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting CDK8 monoclonal antibody, clone 5H4. Western Blot analysis of CDK8 expression in NIH/3T3.
Western Blotting CDK8 monoclonal antibody, clone 5H4. Western Blot analysis of CDK8 expression in Raw 264.7.
Western Blotting CDK8 monoclonal antibody, clone 5H4 Western Blot analysis of CDK8 expression in HeLa S3 NE.
Western Blotting CDK8 monoclonal antibody, clone 5H4. Western Blot analysis of CDK8 expression in PC-12.
Western Blotting CDK8 monoclonal antibody, clone 5H4. Western Blot analysis of CDK8 expression in K-562.
Western Blotting CDK8 monoclonal antibody, clone 5H4. Western Blot analysis of CDK8 expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (35.53 kDa).
ELISA Detection limit for recombinant GST tagged CDK8 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5H4, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
mol wt antigen 35.53 kDa
NCBI accession no. NM_001260 
Quality Level 100 
shipped in dry ice
species reactivity human,
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P49336 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the ′Mediator-like′ protein complexes and the basal transcription machinery. (provided by RefSeq)
Immunogen: CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top