Advanced Search



ANTI-TAF11 antibody produced in mouse

SIGMA/SAB1412319 - clone 2G9, purified immunoglobulin, buffered aqueous solution

Synonym: MGC:15243; PRO2134; TAF11; TAF2I; TAFII28

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1412319-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TAF11 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TAF11 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting TAF11 monoclonal antibody, clone 2G9 Western Blot analysis of TAF11 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (31.46 kDa).
ELISA Detection limit for recombinant GST tagged TAF11 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2G9, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
mol wt antigen 31.46 kDa
NCBI accession no. NM_005643 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15544 
General description: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. (provided by RefSeq)
Immunogen: TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top