Advanced Search



ANTI-HMGB2 antibody produced in mouse

SIGMA/SAB1412391 - clone 3D2, purified immunoglobulin, buffered aqueous solution

Synonym: HMG2; HMGB2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1412391-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to HMGB2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to HMGB2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting HMGB2 monoclonal antibody, clone 3D2 Western Blot analysis of HMGB2 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (47.19 kDa).
ELISA Detection limit for recombinant GST tagged HMGB2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3D2, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen 47.19 kDa
NCBI accession no. BC000903 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P26583 
Biochem/physiol Actions: High-mobility group protein B2 (HMGB2) functions as a significant prognostic factor and may play a crucial role in cell invasion. The gene acts as a novel prognostic marker and an attractive therapeutic target for glioblastoma multiforme (GBM). The protein helps in altering DNA elasticity while facilitating transcription, replication and DNA repair. It plays a significant role in tumor development and during prognosis of hepatocellular carcinoma (HCC). It may also be associated with the anti-apoptotic pathway.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein encoded by the HMGB2 gene in humans. The protein belongs to a family of chromatin proteins made up of two basic DNA binding domains, HMG box A and B, and a C-terminal acidic tail. The gene is mapped to human chromosome 4q34.
Immunogen: HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top