Advanced Search



ANTI-ZIC1 antibody produced in mouse

SIGMA/SAB1412579 - clone 1E6, purified immunoglobulin, buffered aqueous solution

Synonym: ZIC; ZIC1; ZNF201

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1412579-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting ZIC1 monoclonal antibody, clone 1E6. Western Blot analysis of ZIC1 expression in MCF-7.
Western Blotting QC Western Blot detection against Immunogen (34.14 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1E6, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG2aκ
mol wt antigen 33.77 kDa
NCBI accession no. NM_003412 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15915 
General description: This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. (provided by RefSeq)
Immunogen: ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGAGA
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top