Advanced Search



ANTI-PTK2 antibody produced in mouse

SIGMA/SAB1412655 - clone 1D7, purified immunoglobulin, buffered aqueous solution

Synonym: FADK; FAK; FAK1; PTK2; pp125FAK

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB1412655-50UG 50 µg
$580.00
1/EA
Add To Favorites
Western Blotting PTK2 monoclonal antibody, clone 1D7. Western Blot analysis of PTK2 expression in Jurkat.
Western Blotting PTK2 monoclonal antibody, clone 1D7 Western Blot analysis of PTK2 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (40.59 kDa).
ELISA Detection limit for recombinant GST tagged PTK2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1D7, monoclonal
conjugate unconjugated
form buffered aqueous solution
isotype IgG1κ
mol wt antigen 40.59 kDa
NCBI accession no. BC028733 
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q05397 
General description: This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. At least four transcript variants encoding four different isoforms have been found for this gene, but the full-length natures of only two of them have been determined. (provided by RefSeq)
Immunogen: PTK2 (AAH28733, 355 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top