Anti-GALNT4 (ab2) antibody produced in rabbit

SIGMA/SAB2100891 - affinity isolated antibody

Synonym: Anti-GALNAC-T4; Anti-GalNAcT4; Anti-UDP-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-SAB2100891-100UL	100 µL	$580.00 1/EA	Add To Favorites

Immunoblotting Anti-GALNT4 (ab2): Cat. No.SAB2100891: GALNT4 in Fetal Brain tissue lysate with GALNT4 antibody at 1.0 μg/mL.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	67 kDa
Quality Level	100
shipped in	wet ice
species reactivity	mouse, human, rat, bovine
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	western blot: suitable
UniProt accession no.	Q8N4A0

Biochem/physiol Actions:	GALNT4 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It has a highest activity toward Muc7, EA2 and Muc2, with a lowest activity than GALNT2. This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. In vitro, the encoded protein can complement other GalNAc-Ts in the complete O-glycosylation of the mucin-1 tandem repeat and can O-glycosylate the P-selectin glycoprotein ligand-1 molecule. The coding region of this gene is contained within a single exon.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen:	Synthetic peptide directed towards the C terminal region of human GALNT4
Other Notes:	Synthetic peptide located within the following region: ANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCP
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote