Anti-GNAS antibody produced in rabbit

SIGMA/SAB2100941 - affinity isolated antibody

Synonym: Anti-AHO; Anti-C20orf45; Anti-GNAS complex locus; Anti-GPSA

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-SAB2100941-100UL	100 µL	$529.00 1/EA	Add To Favorites

Immunohistochemistry Anti-GNAS: Cat. No. SAB2100941: Immunohistochemistry of GNAS in Human Pancreas tissue with GNAS antibody at 5.0 μg/mL.

Immunoblotting Anti-GNAS: Cat. No.SAB2100941: GNAS in MCF7 cell lysate with GNAS antibody at 1.0 μg/mL.

Immunoblotting GNAS: Cat. No. SAB2100941: Western blot analysis of GNAS in INS1 cell lysates with GNAS antibody at 1.0 μg/mL.

Immunoblotting GNAS Antibody: Cat. No. SAB2100941: Western Blot analysis of GNAS in Human Pancreas cell lysates with GNAS Antibody at 1.0 μg/mL.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	46 kDa
Quality Level	100
shipped in	wet ice
species reactivity	guinea pig, horse, dog, bovine, rat, mouse, human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunohistochemistry: suitable
	western blot: suitable
UniProt accession no.	P63092

Biochem/physiol Actions:	Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5′ exons. Some transcripts contains a differentially methylated region (DMR) at their 5′ exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen:	Synthetic peptide directed towards the N terminal region of human GNAS
Other Notes:	Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote