Advanced Search



Anti-IKZF1 antibody produced in rabbit

SIGMA/SAB2101144 - affinity isolated antibody

Synonym: Anti-Hs.54452; Anti-IK1; Anti-IKAROS; Anti-IKAROS family zinc finger 1 (Ikaros); Anti-LYF1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB2101144-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Anti-IKZF1: Cat. No.SAB2101144: IKZF1 in HeLa cell lysate with IKZF1 antibody at 1.0 μg/mL.
Immunoblotting IKZF1: Cat. No. SAB2101144: Western blot analysis of IKZF1 in Human Adult Placenta cell lysates with IKZF1 antibody at 1.0 μg/mL.
Immunoblotting IKZF1: Cat. No. SAB2101144: Western blot analysis of IKZF1 in Human Fetal Muscle cell lysates with IKZF1 antibody at 1.0 μg/mL.
Immunoblotting IKZF1: Cat. No. SAB2101144: Western blot analysis of IKZF1 in Human Fetal Liver cell lysates with IKZF1 antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 57 kDa
Quality Level 100 
shipped in wet ice
species reactivity human, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q13422 
Biochem/physiol Actions: Ikaros positively regulates lymphocyte differentiation and negatively regulates cell proliferation. It plays a role in peripheral lymphocyte homeostasis and negatively regulates follicular B cell activation. Ikaros/IKZF1 is involved in the development of myeloid cells such as red blood cells, platelets, basophils, and neutrophils. Mutations in the IKZF1 gene lead to acute lymphoblastic leukemia (ALL). Downregulation of the IKZF1 gene is observed in the peripheral blood mononuclear cells of systemic lupus erythematosus (SLE) patients. IKZF1 binds and activates the enhancer (delta-A element) of the CD3-delta gene. It functions in the specification and the maturation of the T-lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyltransferase (TDT) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The Ikaros family zinc finger 1 (IKZF1) gene encodes for the Ikaros transcription factor, and is expressed throughout hematopoiesis. IKZF1 protein is made of an N-terminal DNA-binding domain (DBD) and a C-terminal dimerization domain. The IKZF1 gene is mapped on the human chromosome at 7p12.2.
Immunogen: Synthetic peptide directed towards the middle region of human IKZF1
Other Notes: Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top