Advanced Search



Anti-KCNJ12 antibody produced in rabbit

SIGMA/SAB2101216 - affinity isolated antibody

Synonym: Anti-FLJ14167; Anti-IRK2; Anti-KCNJN1; Anti-Kir2.2; Anti-Potassium inwardly-rectifying channel, subfamily J, member 12

MDL Number: MFCD04975338
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB2101216-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry KCNJ12 Antibody: Cat. No. SAB2101216: Immunohistochemistry analysis of KCNJ12 in Skeletal muscle with KCNJ12 Antibody 1.0 μg/mL. Observed Staining: Cytoplasm in hepatocytes
Immunoblotting Anti-KCNJ12: Cat. No.SAB2101216: KCNJ12 in Fetal Brain tissue lysate with KCNJ12 antibody at 1.0 μg/mL.
Western Blotting Western Blot of KCNJ12 in Human Fetal Brain with KCNJ12 antibody at 1 μg/mL
Western Blotting Western Blot of KCNJ12 in Human Fetal Heart with KCNJ12 antibody at 1 μg/mL
Western Blotting Western Blot of KCNJ12 in Human Fetal Lung with KCNJ12 antibody at 1 μg/mL
Western Blotting Western Blot of KCNJ12 in Human Fetal Liver with KCNJ12 antibody at 1 μg/mL
Western Blotting Western Blot of KCNJ12 in Human Fetal Muscle with KCNJ12 antibody at 1 μg/mL
Western Blotting Western Blot of KCNJ12 in Human Adult Placenta with KCNJ12 antibody at 1 μg/mL
Western Blotting Western Blot of KCNJ12 in Human Fetal Stomach with KCNJ12 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 49 kDa
Quality Level 100 
shipped in wet ice
species reactivity mouse, rat, human, guinea pig, horse, dog
storage temp. −20°C
technique(s) western blot: suitable
UniProt accession no. Q14500 
Biochem/physiol Actions: KCNJ12 is an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). This gene is located within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-486 BC027982.1 12-497 487-488 AC068418.5 101651-101652 489-2455 BC027982.1 500-2466 2456-2483 DA115102.1 132-159 2484-2485 AC068418.5 141899-141900 2486-2889 DA115102.1 161-564 2890-3454 BM799671.1 118-682 3455-3457 AC068418.5 142870-142872 3458-4692 AK024229.1 926-2160 4693-5230 AK024229.1 2163-2700
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the middle region of human KCNJ12
Other Notes: Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top