Synonym: Anti-CK7, K2C7, K7, MGC129731, MGC3625, SCL; Anti-Keratin 7
MDL Number: MFCD02263412
Product Type: Chemical
Immunohistochemistry KRT7 Antibody: Cat. No. SAB2101306: Immunohistochemistry analysis of KRT7 in Human Bronchial Epithelial Tissue with KRT7 Antibody 5.0 μg/mL. Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue
Immunohistochemistry Immunohistochemistry of KRT7 in Human Lung Tissue with KRT7 antibody at 4-8 μg/mL
Immunoblotting Anti-KRT7: Cat. No.SAB2101306: KRT7 in HepG2 cell lysate with KRT7 antibody at 1.0 μg/mL.
| antibody form |
affinity isolated antibody |
| antibody product type |
primary antibodies |
| biological source |
rabbit |
| clone |
polyclonal |
| concentration |
0.5 mg - 1 mg/mL |
| conjugate |
unconjugated |
| form |
buffered aqueous solution |
| mol wt |
52 kDa |
| Quality Level |
100  |
| shipped in |
wet ice |
| species reactivity |
human |
| storage temp. |
−20°C |
| target post-translational modification |
unmodified |
| technique(s) |
immunohistochemistry: suitable |
| |
western blot: suitable |
| UniProt accession no. |
P08729   |
| Disclaimer: |
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals. |
| Immunogen: |
Synthetic peptide directed towards the N terminal region of human KRT7 |
| Other Notes: |
Synthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV |
| Physical form: |
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| RIDADR |
NONH for all modes of transport |
| WGK Germany |
WGK 3 |
| Flash Point(F) |
Not applicable |
| Flash Point(C) |
Not applicable |
| Storage Temp. |
−20°C |
| UNSPSC |
12352203 |