Advanced Search



Anti-CAMKK2, (N-terminal) antibody produced in rabbit

SIGMA/SAB2103558 - affinity isolated antibody

Synonym: Anti-CAMKK; Anti-CAMKKB; Anti-KIAA0787; Anti-MGC15254

MDL Number: MFCD02262656
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB2103558-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Anti-CAMKK2, antibody produced in rabbit: Cat. No. SAB2103558: Immunoblotting analysis of CAMKK2 in 721_B cell lysate with CAMKK2 anitbody at 1 μg/mL.
Immunoblotting CAMKK2: Cat. No. SAB2103558: Western blot analysis of CAMKK2 in Human Adult Placenta cell lysates with CAMKK2 antibody at 1.0 μg/mL.
Immunoblotting CAMKK2: Cat. No. SAB2103558: Western blot analysis of CAMKK2 in Human HepG2 cell lysates with CAMKK2 antibody at 1.0 μg/mL.
Immunoblotting CAMKK2: Cat. No. SAB2103558: Western blot analysis of CAMKK2 in Human Jurkat cell lysates with CAMKK2 antibody at 1.0 μg/mL.
Immunoblotting CAMKK2: Cat. No. SAB2103558: Western blot analysis of CAMKK2 in Human MCF7 cell lysates with CAMKK2 antibody at 1.0 μg/mL.
Immunoblotting CAMKK2: Cat. No. SAB2103558: Western blot analysis of CAMKK2 in Human HeLa cell lysates with CAMKK2 antibody at 1.0 μg/mL.
Immunoblotting CAMKK2: Cat. No. SAB2103558: Western blot analysis of CAMKK2 in Human Fetal Liver cell lysates with CAMKK2 antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 55 kDa
NCBI accession no. NM_153500 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q96RR4 
Biochem/physiol Actions: CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human CAMKK2
Other Notes: Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top