Anti-GRIN2B antibody produced in rabbit

SIGMA/SAB2104208 - affinity isolated antibody

Synonym: Anti-MGC142178; Anti-MGC142180; Anti-NMDAR2B; Anti-NR2B; Anti-hNR3

MDL Number: MFCD00243314
Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-SAB2104208-100UL	100 µL	$580.00 1/EA	Add To Favorites

Immunohistochemistry Immunohistochemistry of GRIN2B in Rat hippocampal with GRIN2B antibody at 4-8 μg/mL

Immunoblotting Anti-GRIN2B, antibody produced in rabbit: Cat. No. SAB2104208: Immunoblotting analysis of GRIN2B in fetal brain tissue lysate with GRIN2B anitbody at 1 μg/mL.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	163 kDa
NCBI accession no.	NM_000834
Quality Level	100
shipped in	wet ice
species reactivity	rabbit, human, horse, rat, mouse
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunohistochemistry: suitable
	western blot: suitable
UniProt accession no.	Q13224

Biochem/physiol Actions:	GRIN2B is the NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium.N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of three different subunits: NR1 (GRIN1), NR2 (GRIN2A, GRIN2B, GRIN2C, or GRIN2D) and NR3 (GRIN3A or GRIN3B). The NR2 subunit acts as the agonist binding site for glutamate. This receptor is the predominant excitatory neurotransmitter receptor in the mammalian brain. Sequence Note: This RefSeq was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-544 U90278.1 31-574 545-545 U88963.1 545-545 546-3677 U90278.1 576-3707 3678-5941 AC007535.3 145452-147715
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen:	Synthetic peptide directed towards the middle region of human GRIN2B
Other Notes:	Synthetic peptide located within the following region: RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote