Anti-SRD5A2, (N-terminal) antibody produced in rabbit

SIGMA/SAB2105568 - affinity isolated antibody

Synonym: Anti-MGC138457

Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-SAB2105568-100UL	100 µL	$580.00 1/EA	Add To Favorites

Immunoblotting Anti-SRD5A2 (N-Terminal): Cat. No. SAB2105568: SRD5A2 in HepG2 cell lysates with SRD5A2 antibody at 1.0 μg/mL.

Immunoblotting SRD5A2: Cat. No. SAB2105568: Western blot analysis of SRD5A2 in Monkey brain extract cell lysates with SRD5A2 antibody at 1.0 μg/mL.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5 mg - 1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	28 kDa
NCBI accession no.	NM_000348
Quality Level	100
shipped in	wet ice
species reactivity	bovine, horse, dog, human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	western blot: suitable
UniProt accession no.	P31213

Biochem/physiol Actions:	Steroid 5α-reductase type 2 (SRD5A2) enzyme mediates the conversion of testosterone to dihydrotestosterone (DHT). Mutations in the SRD5A2 gene are associated with an autosomal recessive form of 46, XY differences disorders of sexual development (DSD) in males characterized by underdeveloped and atypical genitalia. Overexpression of the SRD5A2 gene is associated with androgenic alopecia, benign prostatic hyperplasia (BPH), and prostate cancer. This gene is expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudo-hermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description:	Steroid 5α-reductase type 2 (SRD5A2) enzyme is expressed in the male reproductory system and contains an N-terminal testosterone-binding domain and a C-terminal nicotinamide adenine dinucleotide phosphate (NADPH)-binding domain. The SRD5A2 gene is mapped on the human chromosome at 2p23.1.
Immunogen:	Synthetic peptide directed towards the N terminal region of human SRD5A2
Other Notes:	Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote