Advanced Search



Anti-UBE2O antibody produced in rabbit

SIGMA/SAB2106136 - affinity isolated antibody

Synonym: Anti-E2-230K; Anti-FLJ12878; Anti-KIAA1734

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAB2106136-100UL 100 µL
$541.00
1/EA
Add To Favorites
Immunoblotting Anti-UBE2O: Cat. No. SAB2106136: UBE2O in RPMI-8226 cell lysates with UBE2O antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 141 kDa
NCBI accession no. NM_022066 
shipped in wet ice
species reactivity bovine, guinea pig, mouse, rat, horse, human, dog, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q9C0C9 
Biochem/physiol Actions: The E2 enzyme encoded by the gene UBE2O (ubiquitin conjugating enzyme E2 O) negatively regulates TRAF6-mediated IL-1R (interleukin-1R)/TLR4 (toll-like receptor4) signaling via the inhibition of polyubiquitination of TRAF6 (tumor necrosis factors receptor associated factor 6). It hinders the formation of MyD88-TRAF6 protein complex. It prevents TRAF6-dependent NF-κB (nuclear factor-κB) signaling. It is involved in the ubiquitination of the nuclear localization signal of BAP1 (BRCA1 associated protein 1), a tumor suppressor that regulates cell proliferation. UBE2O interacts and monoubiquitinates SMAD6, an inhibitory regulator of bone morphogenetic protein (BMP)/SMAD signaling, thereby regulating BMP7 (bone morphogenetic protein)-induced adipogenesis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The gene UBE2O (ubiquitin conjugating enzyme E2 O) encodes a member of the E2 family of ubiquitin-conjugating enzymes. The encoded protein is large with a molar mass of 140kDa. It contains a ubiquitin-conjugating (UBC) domain and is expressed ubiquitously, with increased expression in brain, skeletal muscle, and heart tissues. It is found to be up-regulated during the reticulocyte stage of erythroid differentiation.
Immunogen: Synthetic peptide directed towards the middle region of human UBE2O
Other Notes: Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top