Advanced Search



Anti-BDNF antibody produced in rabbit

SIGMA/SAB2108004

Synonym: Anti-ANON2; Anti-BULN2

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB2108004-100UL 100 µL
$500.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemistry of BDNF in Ventral horn region of mouse spinal cord with BDNF antibody at 4-8 μg/mL
Immunoblotting Cell Type: fetal liver (Cat. No. SAB2108004). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type fetal liver
Immunoblotting BDNF Antibody: Cat. No. SAB2108004: Western Blot analysis of BDNF in Human Liver cell lysates with BDNF Antibody at 1.0 μg/mL.
Western Blotting Western Blot of BDNF in Human ACHN with BDNF antibody at 1 μg/mL
Western Blotting Western Blot of BDNF in Mouse Brain with BDNF antibody at 1 μg/mL
Western Blotting Western Blot of BDNF in Mouse Pancreas with BDNF antibody at 1 μg/mL
Western Blotting Western Blot of BDNF in Mouse Testis with BDNF antibody at 1 μg/mL
Western Blotting Western Blot of BDNF in Human Ovary Tumor with BDNF antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 27kDa
NCBI accession no. NM_001709 
Quality Level 100 
shipped in wet ice
species reactivity horse, rat, rabbit, dog, mouse, human, pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: suitable
  immunohistochemistry: suitable
UniProt accession no. P23560 
Application: Anti-BDNF antibody produced in rabbit has been used in immunohistochemistry and western blotting.
Biochem/physiol Actions: Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Hence, variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). It is involved in the pathogenesis of Alzheimer′s disease. ProBDNF interacts with p75 neurotrophin receptor, leading to long-term depression in the hippocampus.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1. BDNF is a member of the neurotrophin family of growth factors. The gene encodes a precursor protein, proBDNF. Mature BDNF (mBDNF) is synthesized by post-translational cleavage of proBDNF. Both proBDNF and mBDNF play crucial roles in cellular signaling.
Immunogen: Synthetic peptide directed towards the middle region of human BDNF
Other Notes: Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top