Advanced Search



Anti-FGF2 antibody produced in rabbit

SIGMA/SAB2108135 - affinity isolated antibody

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB2108135-100UL 100 µL
$500.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemistry of FGF2 in Human A375 with FGF2 antibody at 4-8 μg/mL
Immunohistochemistry Immunohistochemistry of FGF2 in Human Ovary with FGF2 antibody at 4-8 μg/mL
Immunoblotting Anti-FGF2: Cat. No.SAB2108135: FGF2 in Jurkat cell lysate with FGF2 antibody at 1.0 μg/mL.
Western Blotting Western Blot of FGF2 in Human HeLa with FGF2 antibody at 1 μg/mL
Western Blotting Western Blot of FGF2 in Human Lung Tumor with FGF2 antibody at 1 μg/mL
Western Blotting Western Blot of FGF2 in Mouse Skeletal Muscle with FGF2 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
application(s) research pathology
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 31kDa
NCBI accession no. NM_002006 
Quality Level 100 
shipped in wet ice
species reactivity mouse, human, guinea pig, rat, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: suitable
  immunohistochemistry: suitable
UniProt accession no. P09038 
Biochem/physiol Actions: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the middle region of human FGF2
Other Notes: Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top