Advanced Search



Anti-GAPDH antibody produced in rabbit

SIGMA/SAB2108266 - affinity isolated antibody

Product Type: Product-on-demand
Catalog Number PKG Qty. Price Quantity
45-SAB2108266-100UL 100 µL
 $580.00
1/EA		 Add To Favorites
Immunoblotting Anti-GAPDH, antibody produced in rabbit: Cat. No. SAB2108266: Immunoblotting analysis of GAPDH in transfected 293T cell lysate with GAPDH anitbody at 1 μg/mL.
Immunoblotting GAPDH Antibody: Cat. No. SAB2108266: Western Blot analysis of GAPDH in Transfected 293T cell lysates with GAPDH Antibody at 1.0 μg/mL.
Western Blotting Western Blot of GAPDH in Rat heart with GAPDH antibody at 1 μg/mL
Western Blotting Western Blot of GAPDH in Human Raji with GAPDH antibody at 1 μg/mL
Western Blotting Western Blot of GAPDH in Mouse Heart with GAPDH antibody at 1 μg/mL
Western Blotting Western Blot of GAPDH in Rat Brain with GAPDH antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 36kDa
NCBI accession no. NM_002046 
Quality Level 100 
shipped in wet ice
species reactivity guinea pig, rat, horse, human, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: suitable
UniProt accession no. P04406 
Application: Anti-GAPDH antibody produced in rabbit has been used in western blotting.
Biochem/physiol Actions: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) catalyzes the reversible oxidative phosphorylation of glyceraldehyde-phosphate, which is a critical energy-yielding step in carbohydrate metabolism. It binds to several proteins including actin, tubulin, amyloid precursor, polyglutamine peptides, DRPLA (dentatorubral-pallidoluysian atrophy) and huntingtin. Phosphorylated GAPDH associates with cytoskeletal elements and controls microtubule dynamics in the early secretory pathway. GAPDH is also a component of the functional GAIT (interferon-γ-activated inhibitor of translation) mRNP (messenger ribonucleoprotein). GAPDH expression is dysregulated during melanoma progression.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) localizes in the cytoplasm but can be translocated to the nucleus depending on cellular conditions. It is a tetramer containing identical chains. The gene encoding this protein is localized on human chromosome 12p13.
Immunogen: Synthetic peptide directed towards the middle region of human GAPDH
Other Notes: Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:
Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top