Advanced Search



Anti-SOX10 antibody produced in rabbit

SIGMA/SAB2108390 - affinity isolated antibody

Synonym: Anti-DOM; Anti-PCWH; Anti-SOX-10; Anti-WS2E; Anti-WS4; Anti-WS4C

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB2108390-100UL 100 µL
$569.00
1/EA
Add To Favorites
Immunohistochemistry Anti-SOX10: Cat. No. SAB2108390: Immunohistochemistry of SOX10 in Skin tissue with SOX10 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-SOX10: Cat. No. SAB2108390: Immunohistochemistry of SOX10 in Kidney tissue with SOX10 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-SOX10: Cat. No. SAB2108390: Immunohistochemistry of SOX10 in Kidney tissue with SOX10 antibody at 4-8 μg/mL.
Immunoblotting Anti-SOX10: Cat. No. SAB2108390: Western blot analysis of SOX10 with SOX10 (SRY, sex determining region Y)-box 10) antibody against the middle region of SOX10 (50 μg) antibody at 1.0 μg/mL.
Immunoblotting SOX10: Cat. No. SAB2108390: Western blot analysis of SOX10 in Human Jurkat cell lysates with SOX10 antibody at 2.5 μg/mL .
Immunoblotting SOX10 Antibody: Cat. No. SAB2108390: Western Blot analysis of SOX10 in Human HepG2 cell lysates with SOX10 Antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 50kDa
NCBI accession no. NM_006941 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: suitable
  immunohistochemistry: suitable
UniProt accession no. P56693 
Biochem/physiol Actions: SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the middle region of human SOX10
Other Notes: Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top