Anti-GAPDH

SIGMA/SAB2108668 - affinity isolated antibody

Synonym: Anti- GAPD; Anti- MGC88685; Anti-G3PD

Product Type: Product-on-demand

Catalog Number	PKG Qty.	Price


45-SAB2108668-100UL	100 µL	$500.00 1/EA	Add To Favorites

Immunohistochemistry Immunohistochemistry of GAPDH in Human Heart Muscle with GAPDH antibody at 4-8 μg/mL

Immunoblotting Anti-GAPDH: Cat. No. SAB2108668: GAPDH in Fetal Brain tissue lysate with GAPDH antibody at 1.0 μg/mL.

Immunoblotting GAPDH Antibody: Cat. No. SAB2108668: Western Blot analysis of GAPDH in Human brain cell lysates with GAPDH Antibody at 1.0 μg/mL.

Western Blotting Western Blot of GAPDH in Mouse NIH-3T3 with GAPDH antibody at 1 μg/mL

Western Blotting Western Blot of GAPDH in 293T with GAPDH antibody at 1 μg/mL

Western Blotting Western Blot of GAPDH in Human Raji with GAPDH antibody at 1 μg/mL

Properties
Descriptions
Safety Info.
Basic Data

accession no.	NM_002046
antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5-1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	36 kDa
Quality Level	100
shipped in	wet ice
species reactivity	rat, goat, guinea pig, human, rabbit, horse, sheep, dog
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunoblotting: suitable
	immunohistochemistry: suitable
UniProt accession no.	Q2TSD0

Biochem/physiol Actions:	GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen:	Synthetic peptide directed towards the N terminal region of human GAPDH
Other Notes:	Synthetic peptide located within the following region: IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote