Anti-UGT1A1

SIGMA/SAB2108737 - affinity isolated antibody

Synonym: Anti- HUG-BR1; Anti- UDPGT; Anti- UGT1; Anti- UGT1A; Anti-GNT1

Product Type: Product-on-demand

Catalog Number	PKG Qty.	Price	Quantity


45-SAB2108737-100UL	100 µL	$580.00 1/EA		Add To Favorites

Immunoblotting Anti-UGT1A1: Cat. No. SAB2108737: UGT1A1 in Fetal Muscle tissue lysate with UGT1A1 antibody at 1.0 μg/mL.

Properties
Descriptions
Safety Info.
Basic Data

accession no.	NM_000463
antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
concentration	0.5-1 mg/mL
conjugate	unconjugated
form	buffered aqueous solution
mol wt	57 kDa
Quality Level	100
shipped in	wet ice
species reactivity	human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunoblotting: suitable
UniProt accession no.	P22309

Biochem/physiol Actions:	UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5′ exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids. Mutations in this gene result in Crigler-Najjar syndromes types I and II and in Gilbert syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen:	Synthetic peptide directed towards the N terminal region of human UGT1A1
Other Notes:	Synthetic peptide located within the following region: DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
Physical form:	Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

RIDADR	NONH for all modes of transport
WGK Germany	WGK 3
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

Choose a favorite list for this item:

Catalog Number	Description	Price

		$

Please choose a list :

Continue Shopping

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.