Advanced Search



Anti-WT1

SIGMA/SAB2108752 - affinity isolated antibody

Synonym: Anti- AWT1; Anti- WAGR; Anti- WIT-2; Anti- WT33; Anti-GUD

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB2108752-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemistry of WT1 in Human Testis with WT1 antibody at 4-8 μg/mL
Immunoblotting Anti-WT1, antibody produced in rabbit: Cat. No. SAB2108752: Immunoblotting analysis of WT1 in HT1080 cell lysate with WT1 anitbody at 1 μg/mL.
Western Blotting Western Blot of WT1 in Human Jurkat with WT1 antibody at 1 μg/mL
Western Blotting Western Blot of WT1 in Mouse Brain with WT1 antibody at 1 μg/mL

 

accession no. NM_024424
antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5-1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 56 kDa
Quality Level 100 
shipped in wet ice
species reactivity human, rabbit, dog, rat, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: suitable
  immunohistochemistry: suitable
UniProt accession no. P19544 
Biochem/physiol Actions: WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.
Immunogen: Synthetic peptide directed towards the middle region of human WT1
Other Notes: Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top