Advanced Search



Monoclonal Anti-Sur2A - Percp antibody produced in mouse

SIGMA/SAB5200939 - clone S319A-14, purified immunoglobulin

Synonym: Anti-ABC37; Anti-ABCC9; Anti-CMD10; Anti-Sulfonylurea receptor 2A

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB5200939-100UG 100 µg
$598.00
1/EA
Add To Favorites
Immunocytochemistry Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-GluN2A/NR2A Monoclonal Antibody, Clone S327-95 . Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-GluN2A/NR2A Monoclonal Antibody at 1:200 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) GluN2A/NR2A Antibody (D) Composite.
Immunocytochemistry Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-GluN2A/NR2A Monoclonal Antibody, Clone S327-95 . Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-GluN2A/NR2A Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Cell Membrane, Cell Junction. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) GluN2A/NR2A Antibody. (D) Composite.
Western Blotting Western Blot analysis of Monkey COS cells transfected with GFP-tagged NR2A showing detection of ~170 kDa GluN2A/NR2A protein using Mouse Anti-GluN2A/NR2A Monoclonal Antibody, Clone S327-95 . Lane 1: Molecular Weight Ladder. Lane 2: Monkey COS cells transfected with GFP-tagged NR2A. Load: 15 μg. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-GluN2A/NR2A Monoclonal Antibody at 1:200 for 16 hours at 4°C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~170 kDa. Other Band(s): 100 kDa

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone S319A-14, monoclonal
concentration 1 mg/mL
conjugate Peridinin-Chlorophyll-Protein Complex
form buffered aqueous solution
isotype IgG2a
mol wt antigen predicted mol wt 120 kDa
NCBI accession no. NP_001038185.1 
Quality Level 100 
shipped in wet ice
species reactivity mouse, rat
storage temp. −20°C
technique(s) immunocytochemistry: suitable
  immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q63563 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Physical form: PBS pH7.4, 50% glycerol, 0.09% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top