Advanced Search



Monoclonal Anti-Ataxin - Fitc antibody produced in mouse

SIGMA/SAB5201368 - clone S76-8, purified immunoglobulin

Synonym: Anti-ATX1; Anti-D6S504E; Anti-Spinocerebellar ataxia type 1 protein

Product Type: Product-on-demand

Catalog Number PKG Qty. Price Quantity
45-SAB5201368-100UG 100 µg
$463.00
1/EA
Add To Favorites
Immunocytochemistry Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-PINK1 Monoclonal Antibody, Clone S4-15 . Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-PINK1 Monoclonal Antibody at 1:50 for overnight at 4°C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) PINK1 Antibody (D) Composite.
Immunocytochemistry Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-PINK1 Monoclonal Antibody, Clone S4-15 . Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-PINK1 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000; 1:5000 for 60 min RT, 5 min RT. Localization: Cytoplasm. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas Red F-Actin stain. (C) PINK1 Antibody. (D) Composite.
Western Blotting Western Blot analysis of Rat Brain showing detection of ~50 kDa PINK1 protein using Mouse Anti-PINK1 Monoclonal Antibody, Clone S4-15 . Lane 1: Molecular Weight Ladder. Lane 2: Rat Brain. Load: 15 μg. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-PINK1 Monoclonal Antibody at 1:200 for 16 hours at 4°C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~50 kDa.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone S76-8, monoclonal
concentration 1 mg/mL
conjugate FITC conjugate
form buffered aqueous solution
isotype IgG2b
mol wt antigen predicted mol wt 85 kDa
NCBI accession no. NP_001186233.1 
Quality Level 100 
shipped in wet ice
species reactivity mouse, rat, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  immunoprecipitation (IP): suitable
  western blot: suitable
UniProt accession no. P54253 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Physical form: PBS pH 7.4, 50% glycerol, 0.1% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top