Advanced Search



A2A (Adenosine Receptor A2A)

SIGMA/SAE0103 - recombinant, expressed in Sf9 cells

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-SAE0103-10UG 10 µg
$1730.00
1/EA
Add To Favorites
SDS-PAGE Cat. No. SAE0103: Western blotting. Purified A2A was migrated on a 4-15% Tris-glycine SDS-PAGE, transferred to pvdf membrane and immunodetected with a monoclonal anti-ICL3-A2A (7F6-G5-A2, SCBT). Black arrows indicate the target.
SDS-PAGE Cat. No. SAE0103: Stain-Free detection. Purified A2A was migrated on a 4-15% Tris-glycine SDS-PAGE and the total proteins were Stain-Free detected. Black arrows indicate the target. Upper arrows indicate full-length A2A. Lower arrow indicates shorter A2A resulting from partial cleavage of C-term end.
Radio-binding Assay Cat. No. SAE0103: Activity measured by radio-binding assay. Binding of [3H]ZM241385 was measured on purified A2A. A KD of 6 nM was determined for ZM241385.

 

assay ≥90% (SDS-PAGE)
concentration 1.72 mg/mL
description N-Terminal contains a strep tag II and 10X Histidine tag followed by a TEV protease cleavage site.
form aqueous solution
mol wt 47.7 kDa
NCBI accession no. NC_000022.11 
recombinant expressed in Sf9 cells
shipped in dry ice
storage temp. −70°C
UniProt accession no. P29274 
Biochem/physiol Actions: A2A is a class A GPCR involved in regulating myocardial blood flow and hypertension.
Preparation Note: 50mM Hepes pH 7.4, 200mM NaCl, 0.05%/0.006% DDM/CHS
Sequence: MWSHPQFEKHHHHHHHHENLYFQGPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Storage and Stability: Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot into single use aliquots. Store remaining undiluted protein in aliquots at -70°C.
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Purity ≥90% (SDS-PAGE)
Storage Temp. −70°C
UNSPSC 12352202

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top