Synonym: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD, TFA salt; [Gly2]-GLP-2 (human), TFA salt; ALX 0600, TFA salt; ALX-0600, TFA salt; ALX0600, TFA salt; His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp, TFA salt; [Gly2]-Glucagon-like peptide II (human), TFA salt; [Gly2]GLP-2 (human), TFA salt
Product Type: Chemical
assay |
≥95% (HPLC) |
color |
white to off-white |
form |
powder |
Quality Level |
100 ![External link](https://krackeler.com/images/sigma/ext-link.gif) |
storage condition |
desiccated |
storage temp. |
−20°C |
Biochem/physiol Actions: |
Teduglutide is a dipeptidyl peptidase IV (DPP IV)-resistant glucagon-like peptide 2 (GLP-2) analog with clinical efficacy for the treatment of gastrointestinal diseases, including short bowel syndrome (SBS), by promoting crypt cell proliferation, villus height expansion, and nutrient absorption. Experimental models of intestinal injury suggest that GLP-2 signaling exerts protective effects by increasing mesenteric blood flow, reducing intestinal inflammation, and facilitating structural and functional adaptation following major small bowel resection. |
Purity |
≥95% (HPLC) |
Storage Temp. |
−20°C |
UNSPSC |
12352200 |