Advanced Search



Monoclonal Anti-ACP1 antibody produced in mouse

SIGMA/WH0000052M1 - clone 4B10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HAAP; Anti-MGC111030; Anti-MGC3499; Anti-acid phosphatase 1, soluble

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000052M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting ACP1 monoclonal antibody, clone 4B10. Western Blot analysis of ACP1 expression in PC-12.
Western Blotting ACP1 monoclonal antibody, clone 4B10. Western Blot analysis of ACP1 expression in NIH/3T3.
Western Blotting Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody, clone 4B10. Lanes Lane 1: ACP1 transfected lysate (18 kDa). Lane 2: Non-transfected lysate.
Western Blotting ACP1 monoclonal antibody, clone 4B10. Western Blot analysis of ACP1 expression in HeLa.
Western Blotting ACP1 monoclonal antibody, clone 4B10. Western Blot analysis of ACP1 expression in Raw 264.7.
Western Blotting QC Western Blot detection against Immunogen (43.12 kDa).
ELISA Detection limit for recombinant GST tagged ACP1 is approximately 3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4B10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC007422 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity mouse, rat, human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P24666 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. (provided by RefSeq)
Immunogen: ACP1 (AAH07422, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top