Advanced Search



Monoclonal Anti-AFP antibody produced in mouse

SIGMA/WH0000174M1 - clone 1G7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FETA; Anti-HPAFP; Anti-alpha-fetoprotein

MDL Number: MFCD00162111
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000174M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to AFP on HepG2 cell. [antibody concentration 30 μg/mL]
Western Blotting AFP monoclonal antibody, clone 1G7 Western Blot analysis of AFP expression in HepG2.
Western Blotting Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody, clone 1G7. Lanes Lane 1: AFP transfected lysate (69 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
Immunoprecipitation Immunoprecipitation of AFP transfected lysate using anti-AFP monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with AFP rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged AFP is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1G7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC027881 
isotype IgGκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P02771 
Application: Monoclonal Anti-AFP antibody produced in mouse has been used in immunocytochemistry.
Biochem/physiol Actions: Alpha-fetoprotein encoded by the gene AFP is involved in the regulation of fatty acids in both fetal and proliferating adult liver cells. Its expression is found to be increased in acute liver injuries, indicating active liver regeneration. It has been associated with fatty liver disease (FLD), a disease that may lead to cirrhosis and hepatocellular carcinoma. It serves as a tumor marker for HCC (hepatocellular carcinoma).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. (provided by RefSeq)
Immunogen: AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top