Advanced Search



Monoclonal Anti-ARF5 antibody produced in mouse

SIGMA/WH0000381M1 - clone 1B4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ADP-ribosylation factor 5

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000381M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15 μg/mL]
Western Blotting ARF5 monoclonal antibody, clone 1B4. Western Blot analysis of ARF5 expression in Raw 264.7.
Western Blotting Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody, clone 1B4. Lanes Lane 1: ARF5 transfected lysate (20.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting ARF5 monoclonal antibody, clone 1B4. Western Blot analysis of ARF5 expression in PC-12.
Western Blotting ARF5 monoclonal antibody, clone 1B4. Western Blot analysis of ARF5 expression in HeLa.
Western Blotting ARF5 monoclonal antibody, clone 1B4 Western Blot analysis of ARF5 expression in A-431.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged ARF5 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1B4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC003043 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P84084 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: ADP-ribosylation factor 5 (ARF5) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. The ARF5 gene spans approximately 3.2kb of genomic DNA and contains six exons and five introns. (provided by RefSeq)
Immunogen: ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top