Advanced Search



Monoclonal Anti-RHOC antibody produced in mouse

SIGMA/WH0000389M1 - clone 2E12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ARH9; Anti-ARHC; Anti-RHOH9; Anti-ras homolog gene family, member C

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000389M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting RHOC monoclonal antibody, clone 2E12 Western Blot analysis of RHOC expression in Jurkat.
Western Blotting RHOC monoclonal antibody, clone 2E12. Western Blot analysis of RHOC expression in PC-12.
Western Blotting Western Blot analysis of RHOC expression in transfected 293T cell line by RHOC monoclonal antibody, clone 2E12. Lanes Lane 1: RHOC transfected lysate (22 kDa). Lane 2: Non-transfected lysate.
Western Blotting RHOC monoclonal antibody, clone 2E12. Western Blot analysis of RHOC expression in NIH/3T3.
Western Blotting QC Western Blot detection against Immunogen (46.97 kDa).
ELISA Detection limit for recombinant GST tagged RHOC is approximately 3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2E12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC007245 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity rat, human, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P08134 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)
Immunogen: RHOC (AAH07245, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top