Advanced Search



Monoclonal Anti-PHOX2A antibody produced in mouse

SIGMA/WH0000401M1 - clone 4F6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ARIX; Anti-CFEOM2; Anti-FEOM2; Anti-MGC52227; Anti-NCAM2; Anti-PMX2A; Anti-paired-like (aristaless) homeobox 2a

MDL Number: MFCD03097135
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000401M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10 μg/mL]
Enhanced Validation-RNAi Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi. Blot probed with PHOX2A monoclonal antibody, clone 4F6. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody, clone 4F6. Lanes Lane 1: PHOX2A transfected lysate (29.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting PHOX2A monoclonal antibody, clone 4F6 Western Blot analysis of PHOX2A expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (35.64 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_005169 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O14813 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles. (provided by RefSeq)
Immunogen: PHOX2A (NP_005160, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top