Advanced Search



Monoclonal Anti-BGN antibody produced in mouse

SIGMA/WH0000633M1 - clone 4E1-1G7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DSPG1; Anti-PGI; Anti-PGS1; Anti-SLRR1A; Anti-biglycan

MDL Number: MFCD02097275
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000633M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to BGN on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 1 ~ 10 μg/mL]
Western Blotting BGN monoclonal antibody, clone 4E1-1G7 Western Blot analysis of BGN expression in HepG2.
Western Blotting Western Blot analysis of BGN expression in transfected 293T cell line by BGN monoclonal antibody, clone 4E1-1G7. Lanes Lane 1: BGN transfected lysate (41.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (66.22 kDa).
Immunoprecipitation Immunoprecipitation of BGN transfected lysate using anti-BGN monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with BGN rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged BGN is 0.03 ng/mL as a capture antibody.
ELISA Detection limit for recombinant GST tagged BGN is 3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4E1-1G7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC002416 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P21810 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome. (provided by RefSeq)
Immunogen: BGN (AAH02416.1, 1 a.a. ~ 368 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top