Advanced Search



Monoclonal Anti-BUB1B antibody produced in mouse

SIGMA/WH0000701M2 - clone 2G5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast); Anti-BUB1beta; Anti-BUBR1; Anti-Bub1A; Anti-MAD3L; Anti-SSK1; Anti-hBUBR1

MDL Number: MFCD04040371
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000701M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to BUB1B on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between CDC20 and BUB1B. HeLa cells were stained with anti-CDC20 rabbit purified polyclonal 1:1200 and anti-BUB1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting BUB1B monoclonal antibody, clone 2G5 Western Blot analysis of BUB1B expression in HeLa S3 NE.
Enhanced Validation-RNAi Western blot analysis of BUB1B over-expressed 293 cell line, cotransfected with BUB1B Validated Chimera RNAi. Blot probed with BUB1B monoclonal antibody (M02) clone 2G5. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of BUB1B expression in transfected 293T cell line by BUB1B monoclonal antibody, clone 2G5. Lanes Lane 1: BUB1B transfected lysate (119.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (39.93 kDa).
ELISA Detection limit for recombinant GST tagged BUB1B is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2G5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC018739 
isotype IgGκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O60566 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. (provided by RefSeq)
Immunogen: BUB1B (AAH18739, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPRFLNLWLKLGR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top