Advanced Search



Monoclonal Anti-CA12 antibody produced in mouse

SIGMA/WH0000771M1 - clone 1D4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CAXII; Anti-FLJ20151; Anti-HsT18816; Anti-carbonic anhydrase XII

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000771M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting Western Blot analysis of CA12 expression in transfected 293T cell line by CA12 monoclonal antibody, clone 1D4. Lanes Lane 1: CA12 transfected lysate (39.5 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of CA12 over-expressed 293 cell line, cotransfected with CA12 Validated Chimera RNAi. Blot probed with CA12 monoclonal antibody, clone 1D4. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged CA12 is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1D4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_206925 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43570 
Biochem/physiol Actions: Carbonic anhydrase 12 (CA12) is used as a diagnostic marker for lung cancer and oral squamous cell carcinoma.CA12 catalyses the reversible hydration of carbon dioxide into protons and bicarbonates. CA12 is expressed in diffuse astrocytomas and is a biomarker for prognosis.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq). Carbonic anhydrase 12 (CA12) is a transmembrane protein, which is associated with neoplastic growth. CA12 is expressed in normal human endometrium, epithelial fluid and HCO3- secretion. CA12 gene is located on human chromosome 15q22.2.
Immunogen: CA12 (NP_996808, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top