Advanced Search



Monoclonal Anti-CASP1 antibody produced in mouse

SIGMA/WH0000834M1 - clone 3D2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ICE; Anti-IL1BC; Anti-P45; Anti-caspase 1, apoptosis-related cysteine protease (interleukin 1, beta, convertase)

MDL Number: MFCD00283496
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000834M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to CASP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 μg/mL]
Western Blotting Western Blot analysis of CASP1 expression in transfected 293T cell line by CASP1 monoclonal antibody, clone 3D2. Lanes Lane 1: CASP1 transfected lysate (35 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged CASP1 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3D2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC062327 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P29466 
Biochem/physiol Actions: Caspase-1 has an ability to transform pro-inflammatory cytokines, interleukin-1 β (IL-1 β) and IL-18 into their active forms. In addition, it also participates in pyroptosis. Elevated expression of the gene has been observed in the aorta of coronary atherosclerosis patients. CASP1 helps in host cell survival by inducing membrane biogenesis to restore the impairment caused by pore-forming toxins.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The caspase-1 (CASP1) /interleukin-1β converting enzyme (ICE) gene, with ten exons, is mapped to human chromosome 11q22.2. The encoded protein contains an N-terminal CARD (caspase activation and recruitment domain), a large P20 subunit and a small P10 subunit. CASP1 is distributed in leukocytes, monocytes and epithelial cells.
General description: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms. (provided by RefSeq)
Immunogen: CASP1 (AAH62327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top