Advanced Search



Monoclonal Anti-CASP2 antibody produced in mouse

SIGMA/WH0000835M10 - clone 1C11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CASP2; Anti-ICH1; Anti-ICH1L; Anti-ICH1L/1S; Anti-NEDD2; Anti-caspase 2, apoptosis-related cysteine peptidase (neural precursor cell expressed, developmentally down-regulated 2)

MDL Number: MFCD01322181
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000835M10-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to CASP2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1C11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC002427 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P42575 
General description: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The proteolytic cleavage of this protein is induced by a variety of apoptotic stimuli. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. (provided by RefSeq)
Immunogen: CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top