Advanced Search



Monoclonal Anti-CBS antibody produced in mouse

SIGMA/WH0000875M1 - clone 3E1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HIP4; Anti-cystathionine-beta-synthase

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000875M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 μg/mL]
Western Blotting CBS monoclonal antibody, clone 3E1. Western Blot analysis of CBS expression in MCF-7.
Enhanced Validation-RNAi Western blot analysis of CBS over-expressed 293 cell line, cotransfected with CBS Validated Chimera RNAi. Blot probed with CBS monoclonal antibody, clone 3E1. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting CBS monoclonal antibody, clone 3E1 Western Blot analysis of CBS expression in HeLa.
Western Blotting Western Blot analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody, clone 3E1. Lanes Lane 1: CBS transfected lysate (61 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
Immunoprecipitation Immunoprecipitation of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with CBS rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged CBS is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E1, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_000071 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P35520 
Biochem/physiol Actions: Cystathionine-β-synthase (CBS) catalyzes the first step in the transsulfuration pathway, where serine and homocysteine is converted to cystathionine and water. In addition, it also acts as a catalyst for various alternative reactions involved in the synthesis of hydrogen sulfide, a novel neuromodulator in the brain. Deficiency of the gene is associated with the development of an autosomal recessive disorder, homocystinuria.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Cystathionine-β-synthase (CBS) also known as histone promoter control protein Hip4, is encoded by the gene mapped to human chromosome 21q22.3. CBS is a homotetramer containing 63kDa subunits. The encoded protein comprises C-terminal domain with a negative regulatory region, the middle domain with the catalytic core and heme-containing N-terminal domain.
General description: The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. (provided by RefSeq)
Immunogen: CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top