Advanced Search



Monoclonal Anti-CCND2 antibody produced in mouse

SIGMA/WH0000894M1 - clone 3B10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-KIAK0002; Anti-MGC102758; Anti-cyclin D2

MDL Number: MFCD00239665
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000894M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 monoclonal antibody, clone 3B10. Lanes Lane 1: CCND2 transfected lysate (33.1 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3B10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC010958 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P30279 
General description: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. (provided by RefSeq)
Immunogen: CCND2 (AAH10958, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top