Advanced Search



Monoclonal Anti-CD5L antibody produced in mouse

SIGMA/WH0000922M1 - clone 1C8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-API6; Anti-CD5 antigen-like (scavenger receptor cysteine rich family); Anti-PRO229; Anti-SPALPHA; Anti-Spalpha

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000922M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting CD5L monoclonal antibody, clone 1C8. Western Blot analysis of CD5L expression in HL-60.
Western Blotting CD5L monoclonal antibody, clone 1C8. Western Blot analysis of CD5L expression in different cell lines.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
Immunoprecipitation Immunoprecipitation of CD5L transfected lysate using anti-CD5L monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with CD5L rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged CD5L is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1C8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC033586 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43866 
Biochem/physiol Actions: CD5 molecule like (CD5L) controls lipid metabolism and regulates T-helper (Th) 17 cell pathogenicity. In addition, it also has an ability to regulate leukocyte migration and inflammatory responses. Overexpression of the protein has been observed in atopic dermatitis (AD) patients. Thus, it can be used as a potential biomarker for AD.
General description: CD5 molecule like (CD5L), also known as apoptosis inhibitor of macrophage (AIM), is encoded by the gene mapped to human chromosome 1q23.1. CD5L is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. It is a soluble protein expressed generally by macrophages in lymphoid and inflamed tissues. This protein is characterized with a potential region of O-linked glycosylation in a Pro-Ser-Thr-rich polypeptide, separating SRCR domains 1 and 2.
Immunogen: CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top