Advanced Search



Monoclonal Anti-TNFSF8 antibody produced in mouse

SIGMA/WH0000944M1 - clone 2E11, ascites fluid

Synonym: Anti-CD153; Anti-CD30L; Anti-CD30LG; Anti-tumor necrosis factor (ligand) superfamily, member 8

MDL Number: MFCD01864203
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000944M1-200UL 200 µL
$580.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of TNFSF8 expression in transfected 293T cell line by TNFSF8 monoclonal antibody, clone 2E11. Lanes Lane 1: TNFSF8 transfected lysate (Predicted MW: 26 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (34.76 kDa).

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 2E11, monoclonal
conjugate unconjugated
GenBank accession no. NM_001244 
isotype IgMκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. P32971 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin′s and some non-Hodgkin′s lymphomas. (provided by RefSeq)
Immunogen: TNFSF8 (NP_001235, 153 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top