Advanced Search



Monoclonal Anti-CDC25A antibody produced in mouse

SIGMA/WH0000993M1 - clone 3D5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CDC25A2; Anti-cell division cycle 25A

MDL Number: MFCD01633248
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000993M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between CCNB1 and CDC25A. Mahlavu cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-CDC25A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged CDC25A is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3D5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC007401 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P30304 
Biochem/physiol Actions: Cell division cycle 25A (CDC25A) plays a crucial role at the Gl/S-phase transition. The protein also facilitates G2 arrest caused by DNA damage or in the presence of unreplicated DNA. CDC25A controls cell cycle progression by dephosphorylating and activating cyclin-CDK complexes. Elevated expression of the gene increases the G1/S and G2/M transitions, which subsequently lead to genomic instability and tumorigenesis. CDC25A expression might be associated with the pathogenesis and progression of hepatocellular carcinoma (HCC).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
General description: The cell division cycle 25A (CDC25A) is a potent human oncogene, mapped to chromosome 3p21.31. The gene codes for a member of Cdc25 phosphatase family.
Immunogen: CDC25A (AAH07401, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top