Advanced Search



Monoclonal Anti-CDC25C antibody produced in mouse

SIGMA/WH0000995M1 - clone 3B11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CDC25; Anti-cell division cycle 25C

MDL Number: MFCD02096040
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0000995M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 μg/mL]
Western Blotting Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody, clone 3B11. Lanes Lane 1: CDC25C transfected lysate (53.312 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi. Blot probed with CDC25C monoclonal antibody, clone 3B11. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting CDC25C monoclonal antibody, clone 3B11 Western Blot analysis of CDC25C expression in HeLa.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
Immunoprecipitation Immunoprecipitation of CDC25C transfected lysate using anti-CDC25C monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with CDC25C rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged CDC25C is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3B11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC019089 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P30307 
General description: This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. (provided by RefSeq)
Immunogen: CDC25C (AAH19089, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top