Advanced Search



Monoclonal Anti-CDX2 antibody produced in mouse

SIGMA/WH0001045M1 - clone 1C7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CDX3; Anti-caudal type homeo box transcription factor 2

MDL Number: MFCD06201931
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001045M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting CDX2 monoclonal antibody, clone 1C7 Western Blot analysis of CDX2 expression in COLO 320 HSR.
Western Blotting CDX2 monoclonal antibody, clone 1C7. Western Blot analysis of CDX2 expression in human parotid gland.
Western Blotting QC Western Blot detection against Immunogen (60.17 kDa).
ELISA Detection limit for recombinant GST tagged CDX2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1C7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC014461 
isotype IgGκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99626 
Biochem/physiol Actions: Caudal-related homoeobox transcription factor 2 (CDX2) is very specific for intestinal mucosa maintenance and homeostasis. Along with β-catenin, CDX2 favors claudin-1 expression regulating tight junctions. This in turn is essential for the epithelial-mesenchymal transition (EMT) in colorectal cancer (CRC). Abnormal expression of CDX2 in the gut is implicated in intestinal-type metaplasias.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Caudal-related homoeobox transcription factor 2 (CDX2) comprises a homeotic DNA-binding domain, transcriptional domain, and a regulatory domain. The CDX2 gene is mapped to human chromosome 13q12.2.
General description: The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al., 1994 [PubMed 7698771]).[supplied by OMIM
Immunogen: CDX2 (AAH14461.1, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top