Advanced Search



Monoclonal Anti-CREM antibody produced in mouse

SIGMA/WH0001390M2 - clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ICER; Anti-MGC111110; Anti-MGC17881; Anti-MGC41893; Anti-cAMP responsive element modulator; Anti-hCREM2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001390M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to CREM on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting CREM monoclonal antibody, clone 3B5. Western Blot analysis of CREM expression in human liver.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged CREM is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3B5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_181571 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q03060 
Biochem/physiol Actions: In mice, cAMP responsive element modulator (CREM) plays a crucial role in spermatid development. CREM is an essential constituent of cAMP-mediated signal transduction, which links extracellular signals to gene regulation. The encoded protein facilitates physiological and developmental function within the hypothalamic-pituitary-gonadal axis. Elevated expression of the gene has been observed in hepatocellular carcinoma (HCC) patients.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: cAMP responsive element modulator (CREM) is encoded by the gene mapped to human chromosome 10p11.21. The encoded protein has tissue specific expression and it belongs to the family of cAMP-responsive promoter element (CRE)-binding factors. CREM contains 3′-located bZIP DNA-binding domains (DBD), kinase-inducible domain (KID) and two glutamine-rich domains.
General description: This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. (provided by RefSeq)
Immunogen: CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top