Advanced Search



Monoclonal Anti-CRKL antibody produced in mouse

SIGMA/WH0001399M3 - clone 4B5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-v-crk sarcoma virus CT10 oncogene homolog (avian)-like

MDL Number: MFCD01633275
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001399M3-100UG 100 µg
$406.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to CRKL on HeLa cell. [antibody concentration 10 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with anti-GAB1 rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with anti-PTK2 rabbit purified polyclonal 1:600 and anti-CRKL mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between HCK and CRKL. Mahlavu cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody, clone 4B5. Lanes Lane 1: CRKL transfected lysate (33.8 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi. Blot probed with CRKL monoclonal antibody, clone 4B5. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged CRKL is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4B5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_005207 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P46109 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic
Immunogen: CRKL (NP_005198, 204 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top