Advanced Search



Monoclonal Anti-CTNNB1 antibody produced in mouse

SIGMA/WH0001499M2 - clone 1C9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CTNNB; Anti-catenin (cadherin-associated protein), beta 1, 88kDa

MDL Number: MFCD00282178
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001499M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to CTNNB1 on HeLa cell. [antibody concentration 10 μg/mL]
Immunofluorescence PC-3 MM2 cells were stained with CTNNB1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between GSK3B and CTNNB1. HeLa cells were stained with anti-GSK3B rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between FLT1 and CTNNB1. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and anti-CTNNB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting Western Blot analysis of CTNNB1 expression in transfected 293T cell line by CTNNB1 monoclonal antibody, clone 1C9. Lanes Lane 1: CTNNB1 transfected lysate (85.5 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of CTNNB1 over-expressed 293 cell line, cotransfected with CTNNB1 Validated Chimera RNAi. Blot probed with CTNNB1 monoclonal antibody, clone 1C9. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged CTNNB1 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1C9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_001904 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P35222 
General description: Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the ′contact inhibition′ signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM
Immunogen: CTNNB1 (AAH58926, 682 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top