Advanced Search



Monoclonal Anti-CYP24A1 antibody produced in mouse

SIGMA/WH0001591M7 - clone 1F8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CP24; Anti-CYP24; Anti-MGC126273; Anti-MGC126274; Anti-P450CC24; Anti-cytochrome P450, family 24, subfamily A, polypeptide 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001591M7-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of CYP24A1 expression in transfected 293T cell line by CYP24A1 monoclonal antibody, clone 1F8. Lanes Lane 1: CYP24A1 transfected lysate (Predicted MW: 11.11 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged CYP24A1 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1F8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_000782 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) capture ELISA: suitable
  ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q07973 
Biochem/physiol Actions: Cytochrome P450 family 24 subfamily A member 1 (CYP24A1) plays a vital role in side-chain oxidation of steroid hormone vitamin D. Variation in or increased expression of CYP24A1 results in colorectal cancer (CRC); thus, CYP24A1 has potential as a biomarker for CRC. Biallelic mutation of CYP24A1 is observed in patients with idiopathic infantile hypercalcemia (IIH), low parathyroid hormone (PTH), renal disease, and it might also increase the risk of nephrocalcinosis in adults. Promoter polymorphism in the CYP24A1 gene leads to thechronic inflammatory skin disease called atopic dermatitis (AD) in adults. CYP24A1 transcript is highly expressed in ovary and lung tumors, but its expression is decreased in breast tumor when compared to the analogous normal tissues.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
Immunogen: CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top