Advanced Search



Monoclonal Anti-DAZ1 antibody produced in mouse

SIGMA/WH0001617M1 - clone 3G10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DAZ; Anti-SPGY; Anti-deleted in azoospermia 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001617M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to DAZ1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to DAZ1 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting DAZ1 monoclonal antibody, clone 3G10. Western Blot analysis of DAZ1 expression in human pancreas.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged DAZ1 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3G10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NG_004755 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9NQZ3 
General description: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains. (provided by RefSeq)
Immunogen: DAZ1 (AAH18119, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top