Advanced Search



Monoclonal Anti-DHFR antibody produced in mouse

SIGMA/WH0001719M1 - clone 2B10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-dihydrofolate reductase

MDL Number: MFCD01633296
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001719M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting DHFR monoclonal antibody, clone 2B10. Western Blot analysis of DHFR expression in PC-12.
Western Blotting DHFR monoclonal antibody, clone 2B10 Western Blot analysis of DHFR expression in HeLa.
Western Blotting Western Blot analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody, clone 2B10. Lanes Lane 1: DHFR transfected lysate (21.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged DHFR is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2B10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC003584 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P00374 
Biochem/physiol Actions: Dihydrofolate reductase (DHFR) is a folate-metabolizing enzyme that catalyzes nicotinamide adenine dinucleotide phosphate (NADPH)-dependent reduction of dihydrofolate (DHF) to tetrahydrofolate (THF), as well as folic acid to DHF. The encoded protein is implicated in regulation of intracellular folate homeostasis and it acts as a key target for cytostatic drugs. Genetic variations in the gene is associated with the development of various neurologic diseases.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Dihydrofolate reductase (DHFR) is encoded by the gene mapped to human chromosome 5q14. The encoded protein belongs to reductase family of enzymes. It is ubiquitously expressed in all organisms. DHFR is characterized with an α/β fold with a central 8-stranded sheet, flanked by four α helices.
General description: Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. (provided by RefSeq)
Immunogen: DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top