Advanced Search



Monoclonal Anti-DLX4 antibody produced in mouse

SIGMA/WH0001748M1 - clone 1F11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-BP1; Anti-DLX7; Anti-DLX8; Anti-DLX9; Anti-distal-less homeobox 4

MDL Number: MFCD04040379
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001748M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Western blot analysis of DLX4 over-expressed 293 cell line, cotransfected with DLX4 Validated Chimera RNAi. Blot probed with DLX4 monoclonal antibody, clone 1F11. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of DLX4 expression in transfected 293T cell line by DLX4 monoclonal antibody, clone 1F11. Lanes Lane 1: DLX4 transfected lysate (26 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.52 kDa).
Immunoprecipitation Immunoprecipitation of DLX4 transfected lysate using anti-DLX4 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with DLX4 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged DLX4 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1F11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC016145 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q92988 
General description: Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function. (provided by RefSeq)
Immunogen: DLX4 (AAH16145, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top